(data stored in ACNUC7421 zone)

EMBL: CP000088.PE165

CP000088.PE165       Location/Qualifiers
FT   CDS             193241..194029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0167"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54205"
FT                   /db_xref="InterPro:IPR014985"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TK9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54205.1"
FT                   /translation="MRTAGGGISYPQPGTTALDRLREGELTVRVAMHQPHYLPWLGLLD
FT                   KIDRCDLFVVLDHVQFERKGWQHRNYVASKNGPVLLTVPVVQRSRDERIMDKSVNNSSP
FT                   WWEKHSRTLAQHCYRKAPFWDEFGAEITAIYERRWEQLVDLSLATTEFVLNAFGITTPM
FT                   VRSSELGEFTVQKSELLAQISAKVGATTMLSGDGARAYLDKDVFDRYGIAVEWQNFQHP
FT                   EYPQHNRKGQEFLPRMAAIDLLLNVGPEGMDLVRQARIAD"
     MRTAGGGISY PQPGTTALDR LREGELTVRV AMHQPHYLPW LGLLDKIDRC DLFVVLDHVQ        60
     FERKGWQHRN YVASKNGPVL LTVPVVQRSR DERIMDKSVN NSSPWWEKHS RTLAQHCYRK       120
     APFWDEFGAE ITAIYERRWE QLVDLSLATT EFVLNAFGIT TPMVRSSELG EFTVQKSELL       180
     AQISAKVGAT TMLSGDGARA YLDKDVFDRY GIAVEWQNFQ HPEYPQHNRK GQEFLPRMAA       240
     IDLLLNVGPE GMDLVRQARI AD                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page