(data stored in ACNUC7421 zone)

EMBL: CP000088.PE166

CP000088.PE166       Location/Qualifiers
FT   CDS             194123..194836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0168"
FT                   /product="conserved hypothetical protein, possibly
FT                   membrane-associated"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54206"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TK8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54206.1"
FT                   /translation="MMIDWSRERILILAPHPDDETLGCGGLMRKAKDAGAEVYIQFMTV
FT                   GDTADNSPKGLSTAEERYQEVKEVAEFYGWDDWHFAFPGDAYHLKLDAVPRFELTNAIE
FT                   RGSPLSIAKLKPTTVIAPHRTSYNQDHQITAEALHTALRPSNTQRRHHPRLVLAYEQAA
FT                   DQWRYDAAPSPNFFVELTKEQVDAKIHAMHLYGTQSHDHPHTRSDETLRSLATLRGMHA
FT                   GVPYAEAYHMMRWLA"
     MMIDWSRERI LILAPHPDDE TLGCGGLMRK AKDAGAEVYI QFMTVGDTAD NSPKGLSTAE        60
     ERYQEVKEVA EFYGWDDWHF AFPGDAYHLK LDAVPRFELT NAIERGSPLS IAKLKPTTVI       120
     APHRTSYNQD HQITAEALHT ALRPSNTQRR HHPRLVLAYE QAADQWRYDA APSPNFFVEL       180
     TKEQVDAKIH AMHLYGTQSH DHPHTRSDET LRSLATLRGM HAGVPYAEAY HMMRWLA          237
//

If you have problems or comments...

PBIL Back to PBIL home page