(data stored in ACNUC7421 zone)

EMBL: CP000088.PE169

CP000088.PE169       Location/Qualifiers
FT   CDS             complement(196277..196651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0171"
FT                   /product="probable conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0171"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54209"
FT                   /db_xref="GOA:Q47TK5"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TK5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54209.1"
FT                   /translation="MGALSRAKRRANDGGDGKEPDYRFTLANERTFLAWIRTALALVAG
FT                   AVAVLHLVPLRWHGGTQLSVGLALAALAVVITCYAPIRWMRVQRAMRHDQPLPTTPLPL
FT                   ITALGIGLICLAVVVGNYLP"
     MGALSRAKRR ANDGGDGKEP DYRFTLANER TFLAWIRTAL ALVAGAVAVL HLVPLRWHGG        60
     TQLSVGLALA ALAVVITCYA PIRWMRVQRA MRHDQPLPTT PLPLITALGI GLICLAVVVG       120
     NYLP                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page