(data stored in ACNUC7421 zone)

EMBL: CP000088.PE183

CP000088.PE183       Location/Qualifiers
FT   CDS             complement(209081..209806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0185"
FT                   /product="preprotein translocase YidC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0185"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54223"
FT                   /db_xref="GOA:Q47TJ1"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TJ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54223.1"
FT                   /translation="MFGLFSAFLAAAHALTMAVHSTLAVFLGPVSAAATIAFLTLAARV
FT                   LTLPLSYLQVRGEKIRARLAPQLYALRERYGHNPERLVAKTRELYAREGASPFAGCLPA
FT                   LAQAPMFTLLYTLFTVPEIDGSANALLALPFAGTPLGSTLPRILASGDLGALPVFAALL
FT                   AALAAVAWANRRWLTLPALSAAPAAGQPTPVPAFVTYLPFLTVVIAAFVPLASGIYLVT
FT                   STTWTVVERLTLRRLVRVD"
     MFGLFSAFLA AAHALTMAVH STLAVFLGPV SAAATIAFLT LAARVLTLPL SYLQVRGEKI        60
     RARLAPQLYA LRERYGHNPE RLVAKTRELY AREGASPFAG CLPALAQAPM FTLLYTLFTV       120
     PEIDGSANAL LALPFAGTPL GSTLPRILAS GDLGALPVFA ALLAALAAVA WANRRWLTLP       180
     ALSAAPAAGQ PTPVPAFVTY LPFLTVVIAA FVPLASGIYL VTSTTWTVVE RLTLRRLVRV       240
     D                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page