(data stored in ACNUC7421 zone)

EMBL: CP000088.PE184

CP000088.PE184       Location/Qualifiers
FT   CDS             complement(209915..210253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0186"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0186"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54224"
FT                   /db_xref="GOA:Q47TJ0"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TJ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54224.1"
FT                   /translation="MSTDRQKDPVRIPTGGAVAFLIFLAQSFLVGVDSVPLDPASLTVA
FT                   ATLAVGAALLWLALPARPVRTESATEPYARTSALRRWQQRVGVVVSAAPNVPGKPRSRA
FT                   PGAAATAA"
     MSTDRQKDPV RIPTGGAVAF LIFLAQSFLV GVDSVPLDPA SLTVAATLAV GAALLWLALP        60
     ARPVRTESAT EPYARTSALR RWQQRVGVVV SAAPNVPGKP RSRAPGAAAT AA               112
//

If you have problems or comments...

PBIL Back to PBIL home page