(data stored in ACNUC7421 zone)

EMBL: CP000088.PE190

CP000088.PE190       Location/Qualifiers
FT   CDS             complement(214616..215782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0192"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0192"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54230"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TI4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54230.1"
FT                   /translation="MNERIPEIFPNLLREDAFPTVRKGGYDKRQVDDFVVRNHNQLRDL
FT                   QERLARAHDELEQLRRELAEAKAKAAVKPEHEQISERLANILRIAEEEAADKRAQVDKE
FT                   VKEIRAKAEEEAKAKIKSAQEQAERIVNGARDEAKELLTSTKQEAERLREEAAKEAERK
FT                   LNEAEARANKIHDVADRRLKRLVATHGEAVRRLNDMRDTLAELLKAEAKAGALDAGLKR
FT                   SDFEGSTDKESASAASSKQSSPQAAEPEGAANAQRPASPDNEPTARLNPADKEPTARLN
FT                   PASSGAAADGKAENQVKSAPAAQGARPIPGRPQGFRYAGPAPTDAGSSPTPPPPSTELT
FT                   GVYQASVPADSASSADSGSSAGSSNAGSSAGSSDSGSSGGSDSSGGGF"
     MNERIPEIFP NLLREDAFPT VRKGGYDKRQ VDDFVVRNHN QLRDLQERLA RAHDELEQLR        60
     RELAEAKAKA AVKPEHEQIS ERLANILRIA EEEAADKRAQ VDKEVKEIRA KAEEEAKAKI       120
     KSAQEQAERI VNGARDEAKE LLTSTKQEAE RLREEAAKEA ERKLNEAEAR ANKIHDVADR       180
     RLKRLVATHG EAVRRLNDMR DTLAELLKAE AKAGALDAGL KRSDFEGSTD KESASAASSK       240
     QSSPQAAEPE GAANAQRPAS PDNEPTARLN PADKEPTARL NPASSGAAAD GKAENQVKSA       300
     PAAQGARPIP GRPQGFRYAG PAPTDAGSSP TPPPPSTELT GVYQASVPAD SASSADSGSS       360
     AGSSNAGSSA GSSDSGSSGG SDSSGGGF                                          388
//

If you have problems or comments...

PBIL Back to PBIL home page