(data stored in ACNUC7421 zone)

EMBL: CP000088.PE194

CP000088.PE194       Location/Qualifiers
FT   CDS             221550..223391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0196"
FT                   /product="Heat shock protein Hsp70"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0196"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54234"
FT                   /db_xref="GOA:Q47TI0"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47TI0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54234.1"
FT                   /translation="MARAVGIDLGTTNSVVAVLEGGEPTVIANAEGARTTPSVVAFAKN
FT                   GEVLVGEIAKRQAVTNVERTIRSVKRHMGTDWKTHIDGKDFTPQQISAFVLQKLKRDAE
FT                   AYLGEEVTDAVITVPAYFSDAERQATKDAGKIAGLNVLRIINEPTSAALAYHLEKEGEA
FT                   TILVFDLGGGTFDVSLLDVGDGVVEVKATHGDNHLGGDDWDQAVVDWLVERFKSSNGID
FT                   LSKDKMAMQRLREAAEKAKIELSSSTETSINLPYITASAEGPLHLDEKLTRAEFQRLTS
FT                   HLLERTKGPFFQVIKDAGISVDQIDHVVLVGGSTRMPAVVDLVRELTGGKEPNKGVNPD
FT                   EVVAVGAALQAGVLKGDVKDVLLLDVTPLSLGIETKGGVFTKLIERNTAIPTKRSEIFT
FT                   TAEDNQPSVQIQVYQGEREIAKYNKKLGVFDLTGIPPAPRGVPQIEVTFDIDANGIVNV
FT                   TAKDLGTGKEQSVTITGGSALPKEDIERMIREAEEYAEQDRKRREEAETRNNAESLVYQ
FT                   TEKVISENEDKIPEDVKNETKEALDGLKKALEGSDIEAIRSASEKVALASQKIGSAIYS
FT                   QSQQASGAAAGGQQNAEDAEVVDAEIVDEEPKREGNS"
     MARAVGIDLG TTNSVVAVLE GGEPTVIANA EGARTTPSVV AFAKNGEVLV GEIAKRQAVT        60
     NVERTIRSVK RHMGTDWKTH IDGKDFTPQQ ISAFVLQKLK RDAEAYLGEE VTDAVITVPA       120
     YFSDAERQAT KDAGKIAGLN VLRIINEPTS AALAYHLEKE GEATILVFDL GGGTFDVSLL       180
     DVGDGVVEVK ATHGDNHLGG DDWDQAVVDW LVERFKSSNG IDLSKDKMAM QRLREAAEKA       240
     KIELSSSTET SINLPYITAS AEGPLHLDEK LTRAEFQRLT SHLLERTKGP FFQVIKDAGI       300
     SVDQIDHVVL VGGSTRMPAV VDLVRELTGG KEPNKGVNPD EVVAVGAALQ AGVLKGDVKD       360
     VLLLDVTPLS LGIETKGGVF TKLIERNTAI PTKRSEIFTT AEDNQPSVQI QVYQGEREIA       420
     KYNKKLGVFD LTGIPPAPRG VPQIEVTFDI DANGIVNVTA KDLGTGKEQS VTITGGSALP       480
     KEDIERMIRE AEEYAEQDRK RREEAETRNN AESLVYQTEK VISENEDKIP EDVKNETKEA       540
     LDGLKKALEG SDIEAIRSAS EKVALASQKI GSAIYSQSQQ ASGAAAGGQQ NAEDAEVVDA       600
     EIVDEEPKRE GNS                                                          613
//

If you have problems or comments...

PBIL Back to PBIL home page