(data stored in ACNUC7421 zone)

EMBL: CP000088.PE20

CP000088.PE20        Location/Qualifiers
FT   CDS             complement(27533..28045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54060"
FT                   /db_xref="GOA:Q47U04"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:Q47U04"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54060.1"
FT                   /translation="MKLVTPGDSAPASVNRYLLPHEQQVITVRRHPAVLLGPTAIVLGS
FT                   LIAAGILSNTSFVTSGAMLAIIWWLWLLVLVWFVWKVAEWSVDYFVITSARLLGTNGLI
FT                   TRQVNMMPLGKVTDMRFERTLLGRLLGYGTFVMESAGQDQALSKIDFIPYPEQLYLEVV
FT                   GLIFPDK"
     MKLVTPGDSA PASVNRYLLP HEQQVITVRR HPAVLLGPTA IVLGSLIAAG ILSNTSFVTS        60
     GAMLAIIWWL WLLVLVWFVW KVAEWSVDYF VITSARLLGT NGLITRQVNM MPLGKVTDMR       120
     FERTLLGRLL GYGTFVMESA GQDQALSKID FIPYPEQLYL EVVGLIFPDK                  170
//

If you have problems or comments...

PBIL Back to PBIL home page