(data stored in ACNUC7421 zone)

EMBL: CP000088.PE209

CP000088.PE209       Location/Qualifiers
FT   CDS             complement(239062..240729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0211"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54249"
FT                   /db_xref="GOA:Q47TG5"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TG5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54249.1"
FT                   /translation="MPQGCTAPSVRSAAAPRDCRDPGRAPGVGLRRSVFRSHAGTQFAD
FT                   WSGLQDACHGRGGRGRHSCTPASDPRPGPAVPAFPACGRLVCAGNSAVACDSGHGPVLP
FT                   FSARSLVRAAHPGLACRTMAAQSSRSSRTPRRPAPPATGTSSRVAVIAMAVLCVTAIAA
FT                   CAILLSYNGIFQIALRGGVTGWAAHLYPGMFILLLLMAFWAIYLLRDAPRRRRIWVDLL
FT                   VLAMILAAAGASALHSLHYELVEWAATLVVAGGPWLALLISFRLLLWIVAQVRGERVAV
FT                   AGEPAAEEPAAGPAPDSPAAPAVEEEPVAVDSGSPAEPPTEPLAVLPRTETSPAATAAP
FT                   SSSEETAPLVSSTPAPRPAAADISAEADLGDDTVRPAPAEQSTAPPEPDRAADERGSLP
FT                   KRVPPAEGSAIRRAAEPSDRPPAAVADEPAELSAGSAVDAELDDADWESITDAEDDWET
FT                   GDTPLADDPSEDETHSEPAEVAAAPQAAPRSSAAGAPHPVSREEAAADDAASVPEQSPP
FT                   PAPRLRRRPIVLRPRRSSPPPLRPPSSEVRSSPTPPEE"
     MPQGCTAPSV RSAAAPRDCR DPGRAPGVGL RRSVFRSHAG TQFADWSGLQ DACHGRGGRG        60
     RHSCTPASDP RPGPAVPAFP ACGRLVCAGN SAVACDSGHG PVLPFSARSL VRAAHPGLAC       120
     RTMAAQSSRS SRTPRRPAPP ATGTSSRVAV IAMAVLCVTA IAACAILLSY NGIFQIALRG       180
     GVTGWAAHLY PGMFILLLLM AFWAIYLLRD APRRRRIWVD LLVLAMILAA AGASALHSLH       240
     YELVEWAATL VVAGGPWLAL LISFRLLLWI VAQVRGERVA VAGEPAAEEP AAGPAPDSPA       300
     APAVEEEPVA VDSGSPAEPP TEPLAVLPRT ETSPAATAAP SSSEETAPLV SSTPAPRPAA       360
     ADISAEADLG DDTVRPAPAE QSTAPPEPDR AADERGSLPK RVPPAEGSAI RRAAEPSDRP       420
     PAAVADEPAE LSAGSAVDAE LDDADWESIT DAEDDWETGD TPLADDPSED ETHSEPAEVA       480
     AAPQAAPRSS AAGAPHPVSR EEAAADDAAS VPEQSPPPAP RLRRRPIVLR PRRSSPPPLR       540
     PPSSEVRSSP TPPEE                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page