(data stored in ACNUC7421 zone)

EMBL: CP000088.PE217

CP000088.PE217       Location/Qualifiers
FT   CDS             247449..247931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0219"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0219"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54257"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TF7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54257.1"
FT                   /translation="MRTAPPAHAQPASGSCSLRAQEESTVCRVSRFFPAAGEPGKPARQ
FT                   ATAAAGVPERAERARSVLSQRGLGAEADAAQSAPQRRSDEAGGAGTVFRGAHEPWSAPD
FT                   DRAEARGRSAGLLSSAWRESMRGGLQLCRMAPELPLPRGVLLWRLVDAGRAQPPAQ"
     MRTAPPAHAQ PASGSCSLRA QEESTVCRVS RFFPAAGEPG KPARQATAAA GVPERAERAR        60
     SVLSQRGLGA EADAAQSAPQ RRSDEAGGAG TVFRGAHEPW SAPDDRAEAR GRSAGLLSSA       120
     WRESMRGGLQ LCRMAPELPL PRGVLLWRLV DAGRAQPPAQ                             160
//

If you have problems or comments...

PBIL Back to PBIL home page