(data stored in ACNUC7421 zone)

EMBL: CP000088.PE220

CP000088.PE220       Location/Qualifiers
FT   CDS             complement(250690..251535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0222"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0222"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54260"
FT                   /db_xref="InterPro:IPR002747"
FT                   /db_xref="InterPro:IPR023227"
FT                   /db_xref="InterPro:IPR023228"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TF4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54260.1"
FT                   /translation="MTDHGGYTCLTFLTDYGTQDGFVAACRAQMLRHAPGLPVIDITHD
FT                   IPPGDVRRGATVLADTVPEFPAAVHIGVVDPGVGTARRSVALAAGGHVLVGPDNGLLVW
FT                   AAEALGGIDTAVELTNESLWRHPVSRTFHGRDIYAPVGARIAAGLPLSEAGQALDPAVL
FT                   VRLSAPLRDVSGGVARGEVHAIDRFGNCQLSLHPEDLRSVVAAPGLPDRVAVRLPDGSH
FT                   TVAVAATFGAVPLGEPVLLTDSAGLLALAVNGGSAAQRFGLGVGAPVVLSRTSSEPMKE
FT                   "
     MTDHGGYTCL TFLTDYGTQD GFVAACRAQM LRHAPGLPVI DITHDIPPGD VRRGATVLAD        60
     TVPEFPAAVH IGVVDPGVGT ARRSVALAAG GHVLVGPDNG LLVWAAEALG GIDTAVELTN       120
     ESLWRHPVSR TFHGRDIYAP VGARIAAGLP LSEAGQALDP AVLVRLSAPL RDVSGGVARG       180
     EVHAIDRFGN CQLSLHPEDL RSVVAAPGLP DRVAVRLPDG SHTVAVAATF GAVPLGEPVL       240
     LTDSAGLLAL AVNGGSAAQR FGLGVGAPVV LSRTSSEPMK E                           281
//

If you have problems or comments...

PBIL Back to PBIL home page