(data stored in ACNUC7421 zone)

EMBL: CP000088.PE227

CP000088.PE227       Location/Qualifiers
FT   CDS             complement(258636..259061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0229"
FT                   /product="putative MutT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0229"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54267"
FT                   /db_xref="GOA:Q47TE7"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TE7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54267.1"
FT                   /translation="MGAVDSATPAVVDALAWVHVRDGRVLQVRPKGKDVFYFPGGKREP
FT                   GENDAEALIREVAEEVSVQLDPATLQLFTVVDAAAHGYPEGTRVRLTCYTAECTGDLAP
FT                   RSEIAELAWFTQADADRCAPAGVRVLAELAQRGLVTR"
     MGAVDSATPA VVDALAWVHV RDGRVLQVRP KGKDVFYFPG GKREPGENDA EALIREVAEE        60
     VSVQLDPATL QLFTVVDAAA HGYPEGTRVR LTCYTAECTG DLAPRSEIAE LAWFTQADAD       120
     RCAPAGVRVL AELAQRGLVT R                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page