(data stored in ACNUC7421 zone)

EMBL: CP000088.PE236

CP000088.PE236       Location/Qualifiers
FT   CDS             complement(266788..268272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0238"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0238"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54276"
FT                   /db_xref="GOA:Q47TD8"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TD8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54276.1"
FT                   /translation="MSETFRPFPPHLADRLRHALLDADYTVSGVRDRLGDIAARALARE
FT                   QVVPALRATGGEERLGLLLRLWWLGEAVPQTALRSLPLTDLAEAGLLTIRDGQARALVQ
FT                   IKPWELADGRPYYTVSDLTVRPGQGQPRPDHVVGAGGASATLAQLIVDGPVERALDLGS
FT                   GCGVQSLHLAERATRVCATDVNPRALWMTRLSCALSGVDNVETRQGSLYEPVQGERFDL
FT                   IVSNPPFVITPETARYTYRESDLPGDAVCAALVSAAPAHLTEGGWCQLLANWLHVDGED
FT                   WRDRVGGWVEGTGCSGWVVQRDVQDPAEYVELWLRDSCEAGSPEYAQRYDAWLDYFERE
FT                   GVKGIGFGWICLRNDAAQDATVRVEELRHEIDQPVGPYLPDVVDGAMSAHRLTDAALLA
FT                   ARVALAPGVREERISVPGAPDPERILLRQTQGLRRVAQVGTVEAALAGVCDGTIPVGPL
FT                   LDAIAELIGQDPAVLRERTPASLRGLIAEGFFRVAR"
     MSETFRPFPP HLADRLRHAL LDADYTVSGV RDRLGDIAAR ALAREQVVPA LRATGGEERL        60
     GLLLRLWWLG EAVPQTALRS LPLTDLAEAG LLTIRDGQAR ALVQIKPWEL ADGRPYYTVS       120
     DLTVRPGQGQ PRPDHVVGAG GASATLAQLI VDGPVERALD LGSGCGVQSL HLAERATRVC       180
     ATDVNPRALW MTRLSCALSG VDNVETRQGS LYEPVQGERF DLIVSNPPFV ITPETARYTY       240
     RESDLPGDAV CAALVSAAPA HLTEGGWCQL LANWLHVDGE DWRDRVGGWV EGTGCSGWVV       300
     QRDVQDPAEY VELWLRDSCE AGSPEYAQRY DAWLDYFERE GVKGIGFGWI CLRNDAAQDA       360
     TVRVEELRHE IDQPVGPYLP DVVDGAMSAH RLTDAALLAA RVALAPGVRE ERISVPGAPD       420
     PERILLRQTQ GLRRVAQVGT VEAALAGVCD GTIPVGPLLD AIAELIGQDP AVLRERTPAS       480
     LRGLIAEGFF RVAR                                                         494
//

If you have problems or comments...

PBIL Back to PBIL home page