(data stored in ACNUC7421 zone)

EMBL: CP000088.PE240

CP000088.PE240       Location/Qualifiers
FT   CDS             271001..272275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0242"
FT                   /product="putative integral membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0242"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54280"
FT                   /db_xref="GOA:Q47TD7"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TD7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54280.1"
FT                   /translation="MFRSLANRNYRLFALGQVISNPGTWMQRIAQEWLVLQLSGGSGIA
FT                   LGVATALQFLPTLLFGLWGGALADRMSKRRLLITSQSMMGLLSLGLGLLVTFGTAQVWH
FT                   VYLFALGLGLVTVVDSPARQSFVVEMVGREDLPNAVALNSASFQLGRVVGPAAAGILIG
FT                   LIGTGPVFLINAVSFAGVITGLLMMRPSELHVSELAPRSKGQVRQGIRYVAGRRDLLLL
FT                   LATVAFVQLFGSNVQNQLALMVNNVFQAGSEAFGLAATFLALGSFTGALIAARREAPRL
FT                   RTVLIGALLFGVLQVVAGLMPGYTALLVALVPMGICFMTFTTSMNAYFQLNVEPQMRGR
FT                   VMAMYMLVFLGVAPIGAPIVGVLADLFGPAVSMVVGGTVSVTIAVSAAMLLGRSLGVKV
FT                   RLRARRPFVDVIRDKGPERRPELEE"
     MFRSLANRNY RLFALGQVIS NPGTWMQRIA QEWLVLQLSG GSGIALGVAT ALQFLPTLLF        60
     GLWGGALADR MSKRRLLITS QSMMGLLSLG LGLLVTFGTA QVWHVYLFAL GLGLVTVVDS       120
     PARQSFVVEM VGREDLPNAV ALNSASFQLG RVVGPAAAGI LIGLIGTGPV FLINAVSFAG       180
     VITGLLMMRP SELHVSELAP RSKGQVRQGI RYVAGRRDLL LLLATVAFVQ LFGSNVQNQL       240
     ALMVNNVFQA GSEAFGLAAT FLALGSFTGA LIAARREAPR LRTVLIGALL FGVLQVVAGL       300
     MPGYTALLVA LVPMGICFMT FTTSMNAYFQ LNVEPQMRGR VMAMYMLVFL GVAPIGAPIV       360
     GVLADLFGPA VSMVVGGTVS VTIAVSAAML LGRSLGVKVR LRARRPFVDV IRDKGPERRP       420
     ELEE                                                                    424
//

If you have problems or comments...

PBIL Back to PBIL home page