(data stored in ACNUC7421 zone)

EMBL: CP000088.PE248

CP000088.PE248       Location/Qualifiers
FT   CDS             279658..281919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0250"
FT                   /product="PAS containing protein phosphatase 2C-like"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0250"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54288"
FT                   /db_xref="GOA:Q47TC9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TC9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54288.1"
FT                   /translation="MKRWGEAFYDDALSGAEVLEQVQIAVVVTDRFSNLRYWNSYATQL
FT                   FGLDDGRDYLGTPLVDIGIHEADHEQLAQLARRVLRGDTWEGTFAVLRKDSTWMHLRAS
FT                   AVPLRPSSGAVEGVVLFITEALRSGRIEEQYGLLDRIGRRLASSLEFEATVKAVAEILV
FT                   PQFADHCFIDLNDHGRLIRRVSVHAEGWTPPPGSWPDVGEEVHYPEKHFVSKALRRMET
FT                   VVVSDYSNPGSTAGVFPNRRSVRVSEQVGVTSVIAAPLRARGVTLGVLTLARSGLTSRD
FT                   KTDYDSFDRDLVGTIASRVAVAIDNARLFEEERDTALAFQNSLLPREFPEFDGLSIAHD
FT                   YIPAKPLEAHGQGIQTQVGGDFYDVIPLSAGRVGIVIGDVEGKGPHAAAVMGQLRAALR
FT                   AFAQADREPAEILRELDEWVRQLGRPDGEGNTWVPSVSCLYMAYDAWSRELTYANAGHQ
FT                   PPLLICGGKVDDLDMAIRDKLLGVKPKGVPGDSVYRQGELTLPPGATLLLYTDGLVARR
FT                   SYDGTVDMEAGLEQLRSRVREVADKDVHQILEVAKRAVPGVADDDTALLVVRSHPEELA
FT                   LKQEWFPAEAPTVAEARHLAVDTFKEWGMDRDQAELACLLVSEIVTNVVIHATPHPVTR
FT                   EFTDDGVKDSDEQLPLDGFDEFDEDWSDLLEEAAEQDEEPVPTSREFLLRLRRGASSVW
FT                   VEVFDHDLRLPRIRTAGAEDEGGRGLYLVDQLAERWGSRPTPDGKAVWFQIPMHQPDSE
FT                   "
     MKRWGEAFYD DALSGAEVLE QVQIAVVVTD RFSNLRYWNS YATQLFGLDD GRDYLGTPLV        60
     DIGIHEADHE QLAQLARRVL RGDTWEGTFA VLRKDSTWMH LRASAVPLRP SSGAVEGVVL       120
     FITEALRSGR IEEQYGLLDR IGRRLASSLE FEATVKAVAE ILVPQFADHC FIDLNDHGRL       180
     IRRVSVHAEG WTPPPGSWPD VGEEVHYPEK HFVSKALRRM ETVVVSDYSN PGSTAGVFPN       240
     RRSVRVSEQV GVTSVIAAPL RARGVTLGVL TLARSGLTSR DKTDYDSFDR DLVGTIASRV       300
     AVAIDNARLF EEERDTALAF QNSLLPREFP EFDGLSIAHD YIPAKPLEAH GQGIQTQVGG       360
     DFYDVIPLSA GRVGIVIGDV EGKGPHAAAV MGQLRAALRA FAQADREPAE ILRELDEWVR       420
     QLGRPDGEGN TWVPSVSCLY MAYDAWSREL TYANAGHQPP LLICGGKVDD LDMAIRDKLL       480
     GVKPKGVPGD SVYRQGELTL PPGATLLLYT DGLVARRSYD GTVDMEAGLE QLRSRVREVA       540
     DKDVHQILEV AKRAVPGVAD DDTALLVVRS HPEELALKQE WFPAEAPTVA EARHLAVDTF       600
     KEWGMDRDQA ELACLLVSEI VTNVVIHATP HPVTREFTDD GVKDSDEQLP LDGFDEFDED       660
     WSDLLEEAAE QDEEPVPTSR EFLLRLRRGA SSVWVEVFDH DLRLPRIRTA GAEDEGGRGL       720
     YLVDQLAERW GSRPTPDGKA VWFQIPMHQP DSE                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page