(data stored in ACNUC7421 zone)

EMBL: CP000088.PE26

CP000088.PE26        Location/Qualifiers
FT   CDS             complement(32519..33625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0028"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0028"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54066"
FT                   /db_xref="GOA:Q47TZ8"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TZ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54066.1"
FT                   /translation="MDTAPLLPSSIRDQFTREVVYLNTATCGLPPRVAHEATLAVERDR
FT                   ARGRLTLDIAHQAVERSRAAFARLVGVPVSRVAVGSQASFFVGLVAASLPPGATVVVAE
FT                   EDFTSVTYPFLAATGRGVTVRPVPLDRIIDAVDTSVDLVSVSVVQSADGRIVDVPALLD
FT                   AAATHGARVLLDTTQSSGWLPIPADRVDYLVCSAYKWLLGPRGACFFAGTDDALAELTP
FT                   IAANWFAAEDITSAFYGTELRLASDARRFDLSPAWASCVGLAPALELLADLGEAALGAH
FT                   NVALANRFCAALGLPPTDSAIVSVAVDAKAQQVLADAGIVAAMRAGRMRCAFHLSTDAA
FT                   DVDRAVEEIGPYLRDANLEEAVRVPGDR"
     MDTAPLLPSS IRDQFTREVV YLNTATCGLP PRVAHEATLA VERDRARGRL TLDIAHQAVE        60
     RSRAAFARLV GVPVSRVAVG SQASFFVGLV AASLPPGATV VVAEEDFTSV TYPFLAATGR       120
     GVTVRPVPLD RIIDAVDTSV DLVSVSVVQS ADGRIVDVPA LLDAAATHGA RVLLDTTQSS       180
     GWLPIPADRV DYLVCSAYKW LLGPRGACFF AGTDDALAEL TPIAANWFAA EDITSAFYGT       240
     ELRLASDARR FDLSPAWASC VGLAPALELL ADLGEAALGA HNVALANRFC AALGLPPTDS       300
     AIVSVAVDAK AQQVLADAGI VAAMRAGRMR CAFHLSTDAA DVDRAVEEIG PYLRDANLEE       360
     AVRVPGDR                                                                368
//

If you have problems or comments...

PBIL Back to PBIL home page