(data stored in ACNUC7421 zone)

EMBL: CP000088.PE263

CP000088.PE263       Location/Qualifiers
FT   CDS             295713..296204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0265"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54303"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TB4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54303.1"
FT                   /translation="MQYLLFCPINPDRFSRTVRSGGGPVTISLTSFPGIPDSVAAARRF
FT                   VTGMLRLCPQTSAPDEVVHRVELIVSELCTNAIRHTRSGDPGQKFHVHVCTDERGVHVE
FT                   VRTLPPRRPRSVPRVVPPEDPFSEHGRGMFLVDQWATQWGTLSPRENGVYFLLAWEPSD
FT                   "
     MQYLLFCPIN PDRFSRTVRS GGGPVTISLT SFPGIPDSVA AARRFVTGML RLCPQTSAPD        60
     EVVHRVELIV SELCTNAIRH TRSGDPGQKF HVHVCTDERG VHVEVRTLPP RRPRSVPRVV       120
     PPEDPFSEHG RGMFLVDQWA TQWGTLSPRE NGVYFLLAWE PSD                         163
//

If you have problems or comments...

PBIL Back to PBIL home page