(data stored in ACNUC7421 zone)

EMBL: CP000088.PE265

CP000088.PE265       Location/Qualifiers
FT   CDS             296910..297866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0267"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54305"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TB2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54305.1"
FT                   /translation="MNHGTRGPPNLEAAVTGQTRREQVSFDSAGVACAGILYHPAEPAP
FT                   GRQPCVVMAHGFTGTMDRLSHYAQRFADAGLTVLTFDYRNFGASGGQPRQLVDIAGQQA
FT                   DWHAAIRFARSRDDIDPDRIALWGSSLGGGHVLTVAADDQRIAAAVAQIPWLGDWRTTR
FT                   DKLRSLADPSTRKLAVAAVRDAWRAWRGRAPLLVKVVGQPGQAAMFTDPSVRRALNVND
FT                   SEDTLWRNEFAPRAVFSFARYAPGSVVDRITVPVLVCAAEQDQEIPFEYVRKVAARNPR
FT                   IELRGYPGRHWEVYRGGESYERVVADQLVFLRGHLGW"
     MNHGTRGPPN LEAAVTGQTR REQVSFDSAG VACAGILYHP AEPAPGRQPC VVMAHGFTGT        60
     MDRLSHYAQR FADAGLTVLT FDYRNFGASG GQPRQLVDIA GQQADWHAAI RFARSRDDID       120
     PDRIALWGSS LGGGHVLTVA ADDQRIAAAV AQIPWLGDWR TTRDKLRSLA DPSTRKLAVA       180
     AVRDAWRAWR GRAPLLVKVV GQPGQAAMFT DPSVRRALNV NDSEDTLWRN EFAPRAVFSF       240
     ARYAPGSVVD RITVPVLVCA AEQDQEIPFE YVRKVAARNP RIELRGYPGR HWEVYRGGES       300
     YERVVADQLV FLRGHLGW                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page