(data stored in ACNUC7421 zone)

EMBL: CP000088.PE268

CP000088.PE268       Location/Qualifiers
FT   CDS             complement(300444..301760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0270"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54308"
FT                   /db_xref="GOA:Q47TA9"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TA9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54308.1"
FT                   /translation="MTDEPPHRSPAGTTAAVLLTVAAVMVTGVVTLATVRSHTPSPLER
FT                   TDADVVADALPRLEFVREALHEGAGTAMQELFPEGYFFTHALYGLTWLSVAQRDPDLQD
FT                   RALREARWSLKRLYSPEGTGPFSSVAVPAYGVFHAGWSAWLRGQIVAVAGGPEQAPEEM
FT                   AALDAAAEEIAEAFEASLAHGTPYLTSYPGQAWPVDNVVAMAALRLRDHLAGEDRYAAL
FT                   FRLWMTEVRARLDPATGLIPHRVDPVTGHPVEGARGTSQTLLLRFLFEIDPEWAAADYT
FT                   VFRELFASEHAMLPGVREYPRGNRSPGDVDSGPLIFGLSASASTVALAGSILAQDTATA
FT                   DALTGFAEATGMAVEWRGKRRYLGGVLPVGDAFLMWALTTVPTVPDRIPAAPTTTVSPW
FT                   WRVPWYALTLLPIAALWWIVLVRWRSLRPPRPVPERSDP"
     MTDEPPHRSP AGTTAAVLLT VAAVMVTGVV TLATVRSHTP SPLERTDADV VADALPRLEF        60
     VREALHEGAG TAMQELFPEG YFFTHALYGL TWLSVAQRDP DLQDRALREA RWSLKRLYSP       120
     EGTGPFSSVA VPAYGVFHAG WSAWLRGQIV AVAGGPEQAP EEMAALDAAA EEIAEAFEAS       180
     LAHGTPYLTS YPGQAWPVDN VVAMAALRLR DHLAGEDRYA ALFRLWMTEV RARLDPATGL       240
     IPHRVDPVTG HPVEGARGTS QTLLLRFLFE IDPEWAAADY TVFRELFASE HAMLPGVREY       300
     PRGNRSPGDV DSGPLIFGLS ASASTVALAG SILAQDTATA DALTGFAEAT GMAVEWRGKR       360
     RYLGGVLPVG DAFLMWALTT VPTVPDRIPA APTTTVSPWW RVPWYALTLL PIAALWWIVL       420
     VRWRSLRPPR PVPERSDP                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page