(data stored in ACNUC7421 zone)

EMBL: CP000088.PE269

CP000088.PE269       Location/Qualifiers
FT   CDS             complement(301822..302904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0271"
FT                   /product="phosphate:acyl-[acyl carrier protein]
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54309"
FT                   /db_xref="GOA:Q47TA8"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47TA8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54309.1"
FT                   /translation="MSSPVTAQRPPAAPPLIAVDAMGGDHAPREIVAGAVRAVREHGLR
FT                   LALVGRSSELAPLVAAEQAARELPIVHAEEALAMHEGALAAWRRARSSVAVGCKLVRQG
FT                   TAAALVSAGSTGGVVSTATVRLRTLPGVLRPALALVLPTTPTPTILLDAGANADAKPEM
FT                   LVQFAHLGAAYARVGHGIAEPRVGILTIGSEPGKGNKLARRAAELLSANATEDRLDFRG
FT                   NIEGHDLLAGLVDVVVTDGFTGNVALKSVEGAVRFAFDEIRAALTSSPLARFGTLFQRR
FT                   ALRELRTRFDSETYGGAVLLGLNGTVVIAHGASRAEGIAHACLLAHNLVVGRITDQIRR
FT                   GIAGVSRTPSWLHRLSAPEE"
     MSSPVTAQRP PAAPPLIAVD AMGGDHAPRE IVAGAVRAVR EHGLRLALVG RSSELAPLVA        60
     AEQAARELPI VHAEEALAMH EGALAAWRRA RSSVAVGCKL VRQGTAAALV SAGSTGGVVS       120
     TATVRLRTLP GVLRPALALV LPTTPTPTIL LDAGANADAK PEMLVQFAHL GAAYARVGHG       180
     IAEPRVGILT IGSEPGKGNK LARRAAELLS ANATEDRLDF RGNIEGHDLL AGLVDVVVTD       240
     GFTGNVALKS VEGAVRFAFD EIRAALTSSP LARFGTLFQR RALRELRTRF DSETYGGAVL       300
     LGLNGTVVIA HGASRAEGIA HACLLAHNLV VGRITDQIRR GIAGVSRTPS WLHRLSAPEE       360
//

If you have problems or comments...

PBIL Back to PBIL home page