(data stored in ACNUC7421 zone)

EMBL: CP000088.PE275

CP000088.PE275       Location/Qualifiers
FT   CDS             complement(308503..309411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0277"
FT                   /product="Surface protein from Gram-positive cocci, anchor
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0277"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54315"
FT                   /db_xref="GOA:Q47TA2"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TA2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54315.1"
FT                   /translation="MRNRQRSLLGGRLSLLVRGIAASGLSAALTFSAISFLAWHTADRS
FT                   VTEPEADSATVLVHDASDISVWECFSPGSGAAGCSEREHHNLPAGVTLPPNAADPRDLA
FT                   ASWPTEWPPPAATRLGGEALNSTSGQHHHSHKPTHHHPTHLPTHSPTHRPPRPTHHHPT
FT                   HHPTHSHHPTHHPTHHPTHSHKPTHHPTHHPTHSHKPTHHPTHHPTHSHKPTHHPTHSH
FT                   KPTHKPTHHPTHSPTHSPTHSHSPSPSVAPTAPSTPGGGTLPVTGSETSAFTVIAAAAA
FT                   FLGAVLIAMTRRRRPARHRLK"
     MRNRQRSLLG GRLSLLVRGI AASGLSAALT FSAISFLAWH TADRSVTEPE ADSATVLVHD        60
     ASDISVWECF SPGSGAAGCS EREHHNLPAG VTLPPNAADP RDLAASWPTE WPPPAATRLG       120
     GEALNSTSGQ HHHSHKPTHH HPTHLPTHSP THRPPRPTHH HPTHHPTHSH HPTHHPTHHP       180
     THSHKPTHHP THHPTHSHKP THHPTHHPTH SHKPTHHPTH SHKPTHKPTH HPTHSPTHSP       240
     THSHSPSPSV APTAPSTPGG GTLPVTGSET SAFTVIAAAA AFLGAVLIAM TRRRRPARHR       300
     LK                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page