(data stored in ACNUC7421 zone)

EMBL: CP000088.PE278

CP000088.PE278       Location/Qualifiers
FT   CDS             312892..314046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0280"
FT                   /product="spermidine/putrescine ABC transporter ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0280"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54318"
FT                   /db_xref="GOA:Q47T99"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47T99"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54318.1"
FT                   /translation="MATTTEKTPAAPGVVATESNQAVPAISLEKVSKTYRSGQVTTTAV
FT                   ESIDLEIRQGEFFSLLGPSGCGKTTTMRMIAGFEEPTSGVVRLSGKDVTGVPPNRRDVN
FT                   MVFQSYALFPHMTVAENVAFGLKRKKVPAAEIRTRVAEMLELVELGDRAKYKPRQLSGG
FT                   QQQRVALARALVNRPSALLLDEPLGALDLKLRQAMQLELKRIQREVGITFVYVTHDQSE
FT                   ALTMSDRIAVMNKGRIEQLGTPAQIYETPATRFVAGFIGTSNILTGTAQRVSDTLVRID
FT                   YGGDQHVLANTPQQMSDLGLVITVRPEKIRLGKDVPDANVSRIRGTVREVVYLGATTHY
FT                   TVRTVDDTDIVVFQQNSSDASNLADHGDTVWLSWRPEHSYVLPG"
     MATTTEKTPA APGVVATESN QAVPAISLEK VSKTYRSGQV TTTAVESIDL EIRQGEFFSL        60
     LGPSGCGKTT TMRMIAGFEE PTSGVVRLSG KDVTGVPPNR RDVNMVFQSY ALFPHMTVAE       120
     NVAFGLKRKK VPAAEIRTRV AEMLELVELG DRAKYKPRQL SGGQQQRVAL ARALVNRPSA       180
     LLLDEPLGAL DLKLRQAMQL ELKRIQREVG ITFVYVTHDQ SEALTMSDRI AVMNKGRIEQ       240
     LGTPAQIYET PATRFVAGFI GTSNILTGTA QRVSDTLVRI DYGGDQHVLA NTPQQMSDLG       300
     LVITVRPEKI RLGKDVPDAN VSRIRGTVRE VVYLGATTHY TVRTVDDTDI VVFQQNSSDA       360
     SNLADHGDTV WLSWRPEHSY VLPG                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page