(data stored in ACNUC7421 zone)

EMBL: CP000088.PE280

CP000088.PE280       Location/Qualifiers
FT   CDS             315345..316208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0282"
FT                   /product="polyamine ABC-transporter, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0282"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54320"
FT                   /db_xref="GOA:Q47T97"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T97"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54320.1"
FT                   /translation="MTRLLNRAAPYLLALPAWIWLGLFFVVPIVGLLWMSLMTGNIIVG
FT                   FQQTFNVGIYPEVITTYWEHILRSLGYGLAATLLCIAIGYPVAYWIAFHGGAHKSTYLL
FT                   LLLLPFFVTQVLRTISWKFLLADDGLILGTLKAIHLLPQDARVLSTSIAVIFGLAYTFL
FT                   PFMVLPIYAVLEQVDHRVVEAAYDLYASRFHAFVHVILPMSLPGVFAGVLLVFVPSSAD
FT                   YVTAWVLGGTHNTMIGNVIQSQYLVNNAYPTAAAITFVLMSVLLIGIFSYAKALGTERV
FT                   MEVQAG"
     MTRLLNRAAP YLLALPAWIW LGLFFVVPIV GLLWMSLMTG NIIVGFQQTF NVGIYPEVIT        60
     TYWEHILRSL GYGLAATLLC IAIGYPVAYW IAFHGGAHKS TYLLLLLLPF FVTQVLRTIS       120
     WKFLLADDGL ILGTLKAIHL LPQDARVLST SIAVIFGLAY TFLPFMVLPI YAVLEQVDHR       180
     VVEAAYDLYA SRFHAFVHVI LPMSLPGVFA GVLLVFVPSS ADYVTAWVLG GTHNTMIGNV       240
     IQSQYLVNNA YPTAAAITFV LMSVLLIGIF SYAKALGTER VMEVQAG                     287
//

If you have problems or comments...

PBIL Back to PBIL home page