(data stored in ACNUC7421 zone)

EMBL: CP000088.PE285

CP000088.PE285       Location/Qualifiers
FT   CDS             323675..325906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0287"
FT                   /product="Protein phosphatase 2C-like, withe GAF domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0287"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54325"
FT                   /db_xref="GOA:Q47T92"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T92"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54325.1"
FT                   /translation="MPHSVTKTVRREFSPTPETVGEARTFVKDTLQHWEVQRSADEIVL
FT                   LTSELVTNAVVHAKTTLELTVSLIGSDVEVVVADRVPHQALPKAGPLRVVLSSDEDSRG
FT                   GLGLALAEAIADTWGVSYSRDDKAVWFRISTQERTKETARSSLSPPRSIRSHPRSSPPE
FT                   PWARLDALLSARLSPSELLERIVEHVRVVLGGDAAYIALATADHTEWEMAAAVGLSAGP
FT                   WRPFRSRIEETFPAATPEARPMINDDLMIASAHRGVLAAAGMRSLVTAPLSVDGRITGL
FT                   IGVASRRVRHFGKNAARRLQEAADRIALTVERARLAQVEIHRRAALSFLAEANDLLSGT
FT                   LDEQMTAALAAQLSTSRLGHWCVVHTVDELGTHQLAFAMHRDENVTDILRDLVTALMPE
FT                   ERRDPGPLWPVEKVVAAGLGDELSLELAQGPGISLPLTAYGRILGRITIGRDVGEDFPK
FT                   EDVDLAADLAQRVSSAMENARLYSAQTSMSEALQRSLLPAREKQPVVPGVDYAVFYQPA
FT                   GERTVVGGDFYDLFATDGRWCFAIGDVCGTGPEAAAVTGLARHTLRALAREGFSPAHIM
FT                   HRLNFAILEESLTIRFLTMLYGEMTPIGPNAERGMHIRLVSAGHPLPLRLNRHGEVTTL
FT                   ATSQPLLGAFEDVEFFTETVEVEPGDVLLAVTDGVTERRNGDEMLGDEGLVEIFSRCSG
FT                   LTAQAVISRIGRELEAFAPGGHTDDTAMLVLRFLEPRPAEQQERMLLGG"
     MPHSVTKTVR REFSPTPETV GEARTFVKDT LQHWEVQRSA DEIVLLTSEL VTNAVVHAKT        60
     TLELTVSLIG SDVEVVVADR VPHQALPKAG PLRVVLSSDE DSRGGLGLAL AEAIADTWGV       120
     SYSRDDKAVW FRISTQERTK ETARSSLSPP RSIRSHPRSS PPEPWARLDA LLSARLSPSE       180
     LLERIVEHVR VVLGGDAAYI ALATADHTEW EMAAAVGLSA GPWRPFRSRI EETFPAATPE       240
     ARPMINDDLM IASAHRGVLA AAGMRSLVTA PLSVDGRITG LIGVASRRVR HFGKNAARRL       300
     QEAADRIALT VERARLAQVE IHRRAALSFL AEANDLLSGT LDEQMTAALA AQLSTSRLGH       360
     WCVVHTVDEL GTHQLAFAMH RDENVTDILR DLVTALMPEE RRDPGPLWPV EKVVAAGLGD       420
     ELSLELAQGP GISLPLTAYG RILGRITIGR DVGEDFPKED VDLAADLAQR VSSAMENARL       480
     YSAQTSMSEA LQRSLLPARE KQPVVPGVDY AVFYQPAGER TVVGGDFYDL FATDGRWCFA       540
     IGDVCGTGPE AAAVTGLARH TLRALAREGF SPAHIMHRLN FAILEESLTI RFLTMLYGEM       600
     TPIGPNAERG MHIRLVSAGH PLPLRLNRHG EVTTLATSQP LLGAFEDVEF FTETVEVEPG       660
     DVLLAVTDGV TERRNGDEML GDEGLVEIFS RCSGLTAQAV ISRIGRELEA FAPGGHTDDT       720
     AMLVLRFLEP RPAEQQERML LGG                                               743
//

If you have problems or comments...

PBIL Back to PBIL home page