(data stored in ACNUC7421 zone)

EMBL: CP000088.PE286

CP000088.PE286       Location/Qualifiers
FT   CDS             complement(325968..326573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0288"
FT                   /product="regulatory protein, LuxR:Response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0288"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54326"
FT                   /db_xref="GOA:Q47T91"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T91"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54326.1"
FT                   /translation="MIRVVLADDERLVRGAIATLLNLEDDVEVVAEVGRGDEVVATVVK
FT                   HRADIAVLDVEMPGMTGLEAAAALHQEVPSCGILILTSFGRPGYLRRALAAGARGFLAK
FT                   DAPVDQLAGAIRTVYRGGRFIDSELAADAMMAGENPLTAREIDVLRAASTGASVAAIAR
FT                   TLHLSEGTVRNYLSSAISKLGEANRIAAIRKANAMGWL"
     MIRVVLADDE RLVRGAIATL LNLEDDVEVV AEVGRGDEVV ATVVKHRADI AVLDVEMPGM        60
     TGLEAAAALH QEVPSCGILI LTSFGRPGYL RRALAAGARG FLAKDAPVDQ LAGAIRTVYR       120
     GGRFIDSELA ADAMMAGENP LTAREIDVLR AASTGASVAA IARTLHLSEG TVRNYLSSAI       180
     SKLGEANRIA AIRKANAMGW L                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page