(data stored in ACNUC7421 zone)

EMBL: CP000088.PE306

CP000088.PE306       Location/Qualifiers
FT   CDS             344716..345510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0308"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54346"
FT                   /db_xref="GOA:Q47T71"
FT                   /db_xref="InterPro:IPR012666"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T71"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54346.1"
FT                   /translation="MSLTSATPSASVRPLRGTYLRLLVRGLLAGLLAGLAAGVVAFFLG
FT                   EPHIEAAIALEEHASHDHGAHGGHSHGDDALVSRTGQQVGLFLATGFAGMSLGVLYASV
FT                   LYAVRRHSRLSGPALALVAAGLGWAAIAAVPFVKYPANPPAVGVPETIDQRTLLWVAAV
FT                   LLGLVAVTAAVALARALPAETSLTSRIVASLAVFLAVVCVGYLALPHINDVGEDFPATL
FT                   LWEFRMASLATQASLWLVLGLAFAWLTERFDRRFAAQTVGVR"
     MSLTSATPSA SVRPLRGTYL RLLVRGLLAG LLAGLAAGVV AFFLGEPHIE AAIALEEHAS        60
     HDHGAHGGHS HGDDALVSRT GQQVGLFLAT GFAGMSLGVL YASVLYAVRR HSRLSGPALA       120
     LVAAGLGWAA IAAVPFVKYP ANPPAVGVPE TIDQRTLLWV AAVLLGLVAV TAAVALARAL       180
     PAETSLTSRI VASLAVFLAV VCVGYLALPH INDVGEDFPA TLLWEFRMAS LATQASLWLV       240
     LGLAFAWLTE RFDRRFAAQT VGVR                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page