(data stored in ACNUC7421 zone)

EMBL: CP000088.PE319

CP000088.PE319       Location/Qualifiers
FT   CDS             362776..363249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0321"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0321"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54359"
FT                   /db_xref="GOA:Q47T58"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T58"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54359.1"
FT                   /translation="MARLLIVHHTTSPSTQAMLEAVLEGARTDEIDGVEVVTRAALAAT
FT                   AVDVLAADAVILGTPANIGYMSGALKHFFDQVYYPCLSETAGLPYTLYVHGNNDTTGAV
FT                   RSVETIAKGMSWHRHRPPVTVVGELSRADREACWELGAVTALAAAERAASRTA"
     MARLLIVHHT TSPSTQAMLE AVLEGARTDE IDGVEVVTRA ALAATAVDVL AADAVILGTP        60
     ANIGYMSGAL KHFFDQVYYP CLSETAGLPY TLYVHGNNDT TGAVRSVETI AKGMSWHRHR       120
     PPVTVVGELS RADREACWEL GAVTALAAAE RAASRTA                                157
//

If you have problems or comments...

PBIL Back to PBIL home page