(data stored in ACNUC7421 zone)

EMBL: CP000088.PE328

CP000088.PE328       Location/Qualifiers
FT   CDS             371614..372273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0330"
FT                   /product="regulatory protein, LuxR:Response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0330"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54368"
FT                   /db_xref="GOA:Q47T49"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T49"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54368.1"
FT                   /translation="MRVIIAEDSVLLRGGMARLLEDAGIEIVAQVGDADALLAAVARHD
FT                   DVDLCLVDVRMPPTYSEEGMHAAIRIRKEHPDVAVLLLSQHVVGTYASQLLGGSASKVG
FT                   YLLKDRVADIDEFLQTLRRIADGGTAIDPEVVAQLLSRNTDNVLDRLSPRETEVLAAMA
FT                   EGLNNAGIAARLFITERAVEKHIRSIFTKLNLLPDTHEHRRVLAVLQYLRASSRQP"
     MRVIIAEDSV LLRGGMARLL EDAGIEIVAQ VGDADALLAA VARHDDVDLC LVDVRMPPTY        60
     SEEGMHAAIR IRKEHPDVAV LLLSQHVVGT YASQLLGGSA SKVGYLLKDR VADIDEFLQT       120
     LRRIADGGTA IDPEVVAQLL SRNTDNVLDR LSPRETEVLA AMAEGLNNAG IAARLFITER       180
     AVEKHIRSIF TKLNLLPDTH EHRRVLAVLQ YLRASSRQP                              219
//

If you have problems or comments...

PBIL Back to PBIL home page