(data stored in ACNUC7421 zone)

EMBL: CP000088.PE330

CP000088.PE330       Location/Qualifiers
FT   CDS             373371..374087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0332"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0332"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54370"
FT                   /db_xref="GOA:Q47T47"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T47"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54370.1"
FT                   /translation="MAANSFSQVWQDVFSVQPDPPLWVVIATGAVALLVVVSGGRVWRV
FT                   ARNVVTIAHEGGHALAALLSGRQLSGIRLHSDTSGVTVSRGRPDGIGMIVTILAGYTAP
FT                   AVVGLAGIILLTAGRITGLLWISILLLAAMLLLIRNVYGVVAVVGTGAVVFAVSWWTPS
FT                   AVQSFFAYLFTWFMLFASVRPVFELQSQRRRHPSPHSDADQLARLTGVPGTMWVMVFAV
FT                   FNLAMVGLGVWLLLFT"
     MAANSFSQVW QDVFSVQPDP PLWVVIATGA VALLVVVSGG RVWRVARNVV TIAHEGGHAL        60
     AALLSGRQLS GIRLHSDTSG VTVSRGRPDG IGMIVTILAG YTAPAVVGLA GIILLTAGRI       120
     TGLLWISILL LAAMLLLIRN VYGVVAVVGT GAVVFAVSWW TPSAVQSFFA YLFTWFMLFA       180
     SVRPVFELQS QRRRHPSPHS DADQLARLTG VPGTMWVMVF AVFNLAMVGL GVWLLLFT         238
//

If you have problems or comments...

PBIL Back to PBIL home page