(data stored in ACNUC7421 zone)

EMBL: CP000088.PE336

CP000088.PE336       Location/Qualifiers
FT   CDS             complement(379767..380867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0338"
FT                   /product="ABC-type Fe3+-siderophore transport system inner
FT                   membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0338"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54376"
FT                   /db_xref="GOA:Q47T41"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T41"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54376.1"
FT                   /translation="MSREQLATVVRDHVDLDDASTARAALVRHMSARATTHALRAGGLA
FT                   AALGVLVLAALLSLAVGAKPIPLSVVWDALWHFDGSYDHTVILGLRGPRTVLGVTVGAA
FT                   LGLAGALMQVLVRNPIADPGLLGVNMGATTAVVAAIYLFGLTGIDAYVWFSFAGAALTA
FT                   LLVYFLGTRGRTSATPVRLALAGTAVSAVLLGLTNGVILFHDFVFQEIRFWQVGSLAGR
FT                   DLAIFGTVAPFLAVGALIALALGWSLNALALGEDLAAALGARIGRIRLWTAIAIVLLCG
FT                   AATAATGPIAFVGLAVPHAARLLTGPDQRWLLPFSAVFGAILLVLSDTLGRVVLPNGEL
FT                   EVGIITALVGAPVFIVLVRRARLVQP"
     MSREQLATVV RDHVDLDDAS TARAALVRHM SARATTHALR AGGLAAALGV LVLAALLSLA        60
     VGAKPIPLSV VWDALWHFDG SYDHTVILGL RGPRTVLGVT VGAALGLAGA LMQVLVRNPI       120
     ADPGLLGVNM GATTAVVAAI YLFGLTGIDA YVWFSFAGAA LTALLVYFLG TRGRTSATPV       180
     RLALAGTAVS AVLLGLTNGV ILFHDFVFQE IRFWQVGSLA GRDLAIFGTV APFLAVGALI       240
     ALALGWSLNA LALGEDLAAA LGARIGRIRL WTAIAIVLLC GAATAATGPI AFVGLAVPHA       300
     ARLLTGPDQR WLLPFSAVFG AILLVLSDTL GRVVLPNGEL EVGIITALVG APVFIVLVRR       360
     ARLVQP                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page