(data stored in ACNUC7421 zone)

EMBL: CP000088.PE340

CP000088.PE340       Location/Qualifiers
FT   CDS             complement(385725..386150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0342"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0342"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54380"
FT                   /db_xref="GOA:Q47T37"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T37"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54380.1"
FT                   /translation="MAFRIAHLPIRLAAGAYILNSGLNKREADADTAAYLHSAASRVLP
FT                   TLRDMPPEKFTRMLSNSEIGLGAALLLPLLPSALVGAALTVFGAGLLGHYFTEPGARME
FT                   DGIRPTPQGLALAKDVWLVGMGLTLLIDGMRPPCPVR"
     MAFRIAHLPI RLAAGAYILN SGLNKREADA DTAAYLHSAA SRVLPTLRDM PPEKFTRMLS        60
     NSEIGLGAAL LLPLLPSALV GAALTVFGAG LLGHYFTEPG ARMEDGIRPT PQGLALAKDV       120
     WLVGMGLTLL IDGMRPPCPV R                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page