(data stored in ACNUC7421 zone)

EMBL: CP000088.PE343

CP000088.PE343       Location/Qualifiers
FT   CDS             complement(388526..388873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0345"
FT                   /product="Na+/H+ antiporter subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0345"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54383"
FT                   /db_xref="GOA:Q47T34"
FT                   /db_xref="InterPro:IPR005133"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T34"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54383.1"
FT                   /translation="MTGTEILDWISVILLLLGAALSFAAGVGLVRFPDLLSRMHTAAKP
FT                   QVMGLVLISVGLGLRLFPDPRVGFLFLVVLFQILTVPVASHIAARVAYRTGRVRRDLIG
FT                   VDELEEQLEPR"
     MTGTEILDWI SVILLLLGAA LSFAAGVGLV RFPDLLSRMH TAAKPQVMGL VLISVGLGLR        60
     LFPDPRVGFL FLVVLFQILT VPVASHIAAR VAYRTGRVRR DLIGVDELEE QLEPR            115
//

If you have problems or comments...

PBIL Back to PBIL home page