(data stored in ACNUC7421 zone)

EMBL: CP000088.PE347

CP000088.PE347       Location/Qualifiers
FT   CDS             complement(391372..392184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0349"
FT                   /product="similar to Multisubunit Na+/H+ antiporter MnhC
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0349"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54387"
FT                   /db_xref="GOA:Q47T30"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T30"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54387.1"
FT                   /translation="MNDTPTLLLVIVIGVLVTAGVTLLLERSLTRILLGVVLLGNGVNL
FT                   LILSAGGAAGGPPLLSLTPEGEMADPLPQAMILTAIVITLGVTAFLLAMAYRSWQLQGN
FT                   DEVQDDAEDRRIATGGERRRLRQYIRAQKRALRQAIRAQRMELEAQIEAQDELEEAERA
FT                   ILREQIAQARRDLDERLEAADDKDRERIIFQADHAQAAALDEAKRRVREARKELAEHRR
FT                   ADREYERRLRRELRQRIRAQKRQLRASIRAERERLARAEDSDMQGVDY"
     MNDTPTLLLV IVIGVLVTAG VTLLLERSLT RILLGVVLLG NGVNLLILSA GGAAGGPPLL        60
     SLTPEGEMAD PLPQAMILTA IVITLGVTAF LLAMAYRSWQ LQGNDEVQDD AEDRRIATGG       120
     ERRRLRQYIR AQKRALRQAI RAQRMELEAQ IEAQDELEEA ERAILREQIA QARRDLDERL       180
     EAADDKDRER IIFQADHAQA AALDEAKRRV REARKELAEH RRADREYERR LRRELRQRIR       240
     AQKRQLRASI RAERERLARA EDSDMQGVDY                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page