(data stored in ACNUC7421 zone)

EMBL: CP000088.PE353

CP000088.PE353       Location/Qualifiers
FT   CDS             complement(399823..400278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0355"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0355"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54393"
FT                   /db_xref="GOA:Q47T24"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T24"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54393.1"
FT                   /translation="MSETTHTAATTRASGPGRLLVAVYALFAVAATGRSTVQILTRFEE
FT                   APLAYSLSALAAAVYIAATVALARSGHTSRRVALAACTFELVGVVAVGLFTLLVPEAFP
FT                   DDTVWSLFGIGYGFVPLVLPVLGLLWLGRSHPRTPDAASSAPPSHRG"
     MSETTHTAAT TRASGPGRLL VAVYALFAVA ATGRSTVQIL TRFEEAPLAY SLSALAAAVY        60
     IAATVALARS GHTSRRVALA ACTFELVGVV AVGLFTLLVP EAFPDDTVWS LFGIGYGFVP       120
     LVLPVLGLLW LGRSHPRTPD AASSAPPSHR G                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page