(data stored in ACNUC7421 zone)

EMBL: CP000088.PE357

CP000088.PE357       Location/Qualifiers
FT   CDS             complement(402740..404368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0359"
FT                   /product="bacterial peptide chain release factor 3 (bRF-3)"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0359"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54397"
FT                   /db_xref="GOA:Q47T20"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T20"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54397.1"
FT                   /translation="MVSVAAQTSTGANEVNREAARRRTFAVISHPDAGKSTLTEALALH
FT                   TEAITSAGAVHGKGDRKGVISDWMEIEQDRGISITSAALRLEYNGCVLNLLDTPGHADF
FT                   SEDTYRVLSAVDCAVMLLDSAKGLEPQTLKLFDVARSRGIPVITFVNKWDRPGREPLEL
FT                   LDEIEQRIGLRPTPLNWPVGVAGDFRGLIDRTAGNRYTKLHRTPGGATKAREEPMDAVQ
FT                   AAEVEGAAWEQAMEELALLEEIGADYDEESFLAGKSSPVLFGAALPNFGVSALLRALIN
FT                   LAPAPAARLDVTGAPRPVDAPFSGFVFKMQANMDRAHRDRMAFVRVCSGRFDRGMVLTH
FT                   ATTGRPFATKYAQAVRGAQRQTVDTAFPGDVIALVNAQALRVGDTLYAGPKVEFPPIPS
FT                   FAPEHFAVARAVDSSRYKQFRRGIEQLDSEGVVQVLVSDVRGEQAPVLAAVGPLQFDVV
FT                   THRMEHEFRAPVELTHLDYSVARRTDAASAPVLHGLSGAEVLTRRSDGELLVLVHNKWR
FT                   LKVIQRDHPDLVMEPLLAGGLVEEE"
     MVSVAAQTST GANEVNREAA RRRTFAVISH PDAGKSTLTE ALALHTEAIT SAGAVHGKGD        60
     RKGVISDWME IEQDRGISIT SAALRLEYNG CVLNLLDTPG HADFSEDTYR VLSAVDCAVM       120
     LLDSAKGLEP QTLKLFDVAR SRGIPVITFV NKWDRPGREP LELLDEIEQR IGLRPTPLNW       180
     PVGVAGDFRG LIDRTAGNRY TKLHRTPGGA TKAREEPMDA VQAAEVEGAA WEQAMEELAL       240
     LEEIGADYDE ESFLAGKSSP VLFGAALPNF GVSALLRALI NLAPAPAARL DVTGAPRPVD       300
     APFSGFVFKM QANMDRAHRD RMAFVRVCSG RFDRGMVLTH ATTGRPFATK YAQAVRGAQR       360
     QTVDTAFPGD VIALVNAQAL RVGDTLYAGP KVEFPPIPSF APEHFAVARA VDSSRYKQFR       420
     RGIEQLDSEG VVQVLVSDVR GEQAPVLAAV GPLQFDVVTH RMEHEFRAPV ELTHLDYSVA       480
     RRTDAASAPV LHGLSGAEVL TRRSDGELLV LVHNKWRLKV IQRDHPDLVM EPLLAGGLVE       540
     EE                                                                      542
//

If you have problems or comments...

PBIL Back to PBIL home page