(data stored in ACNUC7421 zone)

EMBL: CP000088.PE360

CP000088.PE360       Location/Qualifiers
FT   CDS             407623..409056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0362"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0362"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54400"
FT                   /db_xref="GOA:Q47T17"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T17"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54400.1"
FT                   /translation="MTNHSTSRSGTDTAVIVIAADDLSAEVFIDGSRHVVHGADAKATR
FT                   RAALDYVTDHAARIGRPVIIEARDVYGVQRLEALPRGVIRSIPQIPPPAPRNSGKQSGS
FT                   RTGVVLALAAAGLAVVVLVVVSVVLVVPRYLPGFGTQAAPSQQAPETPDTIPFEARSAP
FT                   PGFSSEALWRIPVTEGTRPAVSDDGSRVAFIGADGKLAVAGPEGKRLWEADLPIQPAEI
FT                   EGAVRFVKNDDQWEVAIAGTGKLWIWSADGSGPTEYKLPKDGVVTFAGTAPLVTTDKKA
FT                   MVPREGELLEVKVPKGTGGMLVVGDEVLLAAADGPWYWAAPGEEPAKVTAKEPKSADGL
FT                   DRVITASERYVIVRWQSEKEDKVILAAHDARDGSVFAETEITAGELADATWIEGETVAA
FT                   YGPILTDLESGQTQVLPGFTPLNAVAGVVYGELEEGQVAVNAAGEVTPMEPDTARPWGL
FT                   LDGHAVVMADANLYALLPD"
     MTNHSTSRSG TDTAVIVIAA DDLSAEVFID GSRHVVHGAD AKATRRAALD YVTDHAARIG        60
     RPVIIEARDV YGVQRLEALP RGVIRSIPQI PPPAPRNSGK QSGSRTGVVL ALAAAGLAVV       120
     VLVVVSVVLV VPRYLPGFGT QAAPSQQAPE TPDTIPFEAR SAPPGFSSEA LWRIPVTEGT       180
     RPAVSDDGSR VAFIGADGKL AVAGPEGKRL WEADLPIQPA EIEGAVRFVK NDDQWEVAIA       240
     GTGKLWIWSA DGSGPTEYKL PKDGVVTFAG TAPLVTTDKK AMVPREGELL EVKVPKGTGG       300
     MLVVGDEVLL AAADGPWYWA APGEEPAKVT AKEPKSADGL DRVITASERY VIVRWQSEKE       360
     DKVILAAHDA RDGSVFAETE ITAGELADAT WIEGETVAAY GPILTDLESG QTQVLPGFTP       420
     LNAVAGVVYG ELEEGQVAVN AAGEVTPMEP DTARPWGLLD GHAVVMADAN LYALLPD          477
//

If you have problems or comments...

PBIL Back to PBIL home page