(data stored in ACNUC7421 zone)

EMBL: CP000088.PE362

CP000088.PE362       Location/Qualifiers
FT   CDS             409972..410595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0364"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0364"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54402"
FT                   /db_xref="GOA:Q47T15"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T15"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54402.1"
FT                   /translation="MTVRNRTIAVLLGGLAGLLALPSLGHASPQPDDTVPGRSNDITLS
FT                   ITDSRDRIAVGEDTAYTVTVRNEGEEAAPELLVAQIAPAHLDLREADGGGVIEDNTAAW
FT                   LVSLGPGEEQTRTVTATLVEDPGQDTVATTVCAGWQEADSPLVCADDENTVGAQNGSVP
FT                   LRPFFTGAGIAAAAALLVGLVVAVLRRPRKPRGRHARHRAAARR"
     MTVRNRTIAV LLGGLAGLLA LPSLGHASPQ PDDTVPGRSN DITLSITDSR DRIAVGEDTA        60
     YTVTVRNEGE EAAPELLVAQ IAPAHLDLRE ADGGGVIEDN TAAWLVSLGP GEEQTRTVTA       120
     TLVEDPGQDT VATTVCAGWQ EADSPLVCAD DENTVGAQNG SVPLRPFFTG AGIAAAAALL       180
     VGLVVAVLRR PRKPRGRHAR HRAAARR                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page