(data stored in ACNUC7421 zone)

EMBL: CP000088.PE364

CP000088.PE364       Location/Qualifiers
FT   CDS             complement(411172..411867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0366"
FT                   /product="methylated-DNA (protein)-cysteine
FT                   S-methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0366"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54404"
FT                   /db_xref="GOA:Q47T13"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T13"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54404.1"
FT                   /translation="MRCRAENSLSPPLPHRRTPDTGTSTPAPRTHQGVIVTAEIPARAR
FT                   VHTVVDSPLGPLTLVAADGALVGLYQEDQRHRPAPDSFGVPDPAPFTEVIAQLTEYFSG
FT                   QRTVFDLPLAFTGTPFQTTVWRALLEIPYGQTVSYGELAARIGKPSASRAVGLANGRNP
FT                   ISIIVPCHRVVGSSGSLTGYGGGLARKQWLLALEQRRAHQPPLLDFADGLDAGEPRSAT
FT                   LPMGSHHSA"
     MRCRAENSLS PPLPHRRTPD TGTSTPAPRT HQGVIVTAEI PARARVHTVV DSPLGPLTLV        60
     AADGALVGLY QEDQRHRPAP DSFGVPDPAP FTEVIAQLTE YFSGQRTVFD LPLAFTGTPF       120
     QTTVWRALLE IPYGQTVSYG ELAARIGKPS ASRAVGLANG RNPISIIVPC HRVVGSSGSL       180
     TGYGGGLARK QWLLALEQRR AHQPPLLDFA DGLDAGEPRS ATLPMGSHHS A                231
//

If you have problems or comments...

PBIL Back to PBIL home page