(data stored in ACNUC7421 zone)

EMBL: CP000088.PE38

CP000088.PE38        Location/Qualifiers
FT   CDS             complement(42286..42519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54078"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TY6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54078.1"
FT                   /translation="MRRIMKLAAVGALAAGLVGAGASTAFAHDYTEITATKTAQCVAEQ
FT                   PAVGLGLLAGLGLNVNALNSASCTGSVNVNDN"
     MRRIMKLAAV GALAAGLVGA GASTAFAHDY TEITATKTAQ CVAEQPAVGL GLLAGLGLNV        60
     NALNSASCTG SVNVNDN                                                       77
//

If you have problems or comments...

PBIL Back to PBIL home page