(data stored in ACNUC7421 zone)

EMBL: CP000088.PE380

CP000088.PE380       Location/Qualifiers
FT   CDS             complement(425495..426295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0382"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0382"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54420"
FT                   /db_xref="GOA:Q47SZ7"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SZ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54420.1"
FT                   /translation="MTSHRAVLPKAPAPRLLAGWLAVAAGALTAVTWQVIVGGPVTALD
FT                   WPVHAFVDPRQPEGPLLWAAVATARLGQRLITIPLLVGLAIWAMRRGRGWRPLGAVLTG
FT                   LGSLAVLGTLLKVGVGRTPPVLEVDTVSPGAGNIAAWVYALLVPGAPPFDGYVSFPSGH
FT                   AANAALTYPLAAWLLFGANGVFPHARRLRYALGCSLLPVAAVGVLVTVLDYHWLSESVA
FT                   GWLLGAVVLLVALLVLEARTPDRAAPPHQHAMSQVMADEPPGSG"
     MTSHRAVLPK APAPRLLAGW LAVAAGALTA VTWQVIVGGP VTALDWPVHA FVDPRQPEGP        60
     LLWAAVATAR LGQRLITIPL LVGLAIWAMR RGRGWRPLGA VLTGLGSLAV LGTLLKVGVG       120
     RTPPVLEVDT VSPGAGNIAA WVYALLVPGA PPFDGYVSFP SGHAANAALT YPLAAWLLFG       180
     ANGVFPHARR LRYALGCSLL PVAAVGVLVT VLDYHWLSES VAGWLLGAVV LLVALLVLEA       240
     RTPDRAAPPH QHAMSQVMAD EPPGSG                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page