(data stored in ACNUC7421 zone)

EMBL: CP000088.PE382

CP000088.PE382       Location/Qualifiers
FT   CDS             complement(427452..427655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0384"
FT                   /product="cold-shock DNA-binding protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0384"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54422"
FT                   /db_xref="GOA:Q47SZ5"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SZ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54422.1"
FT                   /translation="MAQGTVKWFNSEKGFGFIAVDGGGPDVFVHYSAIAGTGFRNLEEN
FT                   QAVEFEIVPGPKGPQAADVRAL"
     MAQGTVKWFN SEKGFGFIAV DGGGPDVFVH YSAIAGTGFR NLEENQAVEF EIVPGPKGPQ        60
     AADVRAL                                                                  67
//

If you have problems or comments...

PBIL Back to PBIL home page