(data stored in ACNUC7421 zone)

EMBL: CP000088.PE383

CP000088.PE383       Location/Qualifiers
FT   CDS             complement(427978..429894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0385"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54423"
FT                   /db_xref="GOA:Q47SZ4"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR027005"
FT                   /db_xref="InterPro:IPR032421"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SZ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54423.1"
FT                   /translation="MGGEQYPPPGRRKGVGVFPRRASAAGTYSPTKRMSTTALQDKVSP
FT                   SPESQSLRERLVPALPSPAWLGWVVALVVAAFAGALRFIRLGEPAQIYFDETYYAKDAY
FT                   GLREYGYEHETVENADELLRNGVSHIFAGGGDFVVHPPFGKWLIALGDTVWGLLPFGAT
FT                   FTPTGWRFAAAVFGTLSVLLLVRITQRMTRSIVLGASAGLIMALDGLHFTLSRIAMVDI
FT                   FLTFWILAGFGCLVIDRDRTRARLAEATEAGRATVNAFTAWWWTVVADAARALAPSQTA
FT                   AESDEQTGKHAQPGLRERWAAAAAARAEQARSPEEAAVRWLGVRWWRIAAGVCLGLACG
FT                   TKWTALFYLAAFGLLTVAWDYGARRSVGQRRVWGRWLGYDAIPAFFQMVGTAFVVYLAT
FT                   WSGWLATSGGWGRQWADLTPEVQSYTGFLPGPLREAANALISLGHYHWRMWSFHKDLGE
FT                   PHDFASQPWDWIIMRVPVAFYYDGEGTDCGATACSDAILSIGTPAIWWLSILACGVMLG
FT                   WWVTYRDWRAGAALLGVAAGWLPWFAFPQRTMFLFYALPFLPFLVLAIVLMLGLMLGSP
FT                   GDRPGTSPWSRVVGSVIYGVVMLLIIANFTYLYPVLSAETIPYTEWADRMWFPTWIYGS
FT                   GGN"
     MGGEQYPPPG RRKGVGVFPR RASAAGTYSP TKRMSTTALQ DKVSPSPESQ SLRERLVPAL        60
     PSPAWLGWVV ALVVAAFAGA LRFIRLGEPA QIYFDETYYA KDAYGLREYG YEHETVENAD       120
     ELLRNGVSHI FAGGGDFVVH PPFGKWLIAL GDTVWGLLPF GATFTPTGWR FAAAVFGTLS       180
     VLLLVRITQR MTRSIVLGAS AGLIMALDGL HFTLSRIAMV DIFLTFWILA GFGCLVIDRD       240
     RTRARLAEAT EAGRATVNAF TAWWWTVVAD AARALAPSQT AAESDEQTGK HAQPGLRERW       300
     AAAAAARAEQ ARSPEEAAVR WLGVRWWRIA AGVCLGLACG TKWTALFYLA AFGLLTVAWD       360
     YGARRSVGQR RVWGRWLGYD AIPAFFQMVG TAFVVYLATW SGWLATSGGW GRQWADLTPE       420
     VQSYTGFLPG PLREAANALI SLGHYHWRMW SFHKDLGEPH DFASQPWDWI IMRVPVAFYY       480
     DGEGTDCGAT ACSDAILSIG TPAIWWLSIL ACGVMLGWWV TYRDWRAGAA LLGVAAGWLP       540
     WFAFPQRTMF LFYALPFLPF LVLAIVLMLG LMLGSPGDRP GTSPWSRVVG SVIYGVVMLL       600
     IIANFTYLYP VLSAETIPYT EWADRMWFPT WIYGSGGN                               638
//

If you have problems or comments...

PBIL Back to PBIL home page