(data stored in ACNUC7421 zone)

EMBL: CP000088.PE384

CP000088.PE384       Location/Qualifiers
FT   CDS             430143..431012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0386"
FT                   /product="Protein of unknown function UPF0011"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0386"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54424"
FT                   /db_xref="GOA:Q47SZ3"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SZ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54424.1"
FT                   /translation="MADQQSSTRPGTLTLAGLPIGHRDDTTPRLRAALENAEIIAAEDT
FT                   RRLRQFAARIGVRPGGKRGARIVSYYDANERERAAELLADLQAGHDVLLVTDAGMPGVS
FT                   DPGYRLITACVDAGVPMTVIPGPSAVTAALVLSGLPTDRFCFEGFPPRKGLAAYLAGLA
FT                   DERRTMVFFEAPHRLAATLTAMADAFGPDRPAAVCRELTKTYEEVRRGGLAELAEWAAE
FT                   HARGEITLVVRGAERTTPQATPEALVAAVAAREDQGVPRKQAIQQVAQEYGVPKREVYN
FT                   AVHRTPSD"
     MADQQSSTRP GTLTLAGLPI GHRDDTTPRL RAALENAEII AAEDTRRLRQ FAARIGVRPG        60
     GKRGARIVSY YDANERERAA ELLADLQAGH DVLLVTDAGM PGVSDPGYRL ITACVDAGVP       120
     MTVIPGPSAV TAALVLSGLP TDRFCFEGFP PRKGLAAYLA GLADERRTMV FFEAPHRLAA       180
     TLTAMADAFG PDRPAAVCRE LTKTYEEVRR GGLAELAEWA AEHARGEITL VVRGAERTTP       240
     QATPEALVAA VAAREDQGVP RKQAIQQVAQ EYGVPKREVY NAVHRTPSD                   289
//

If you have problems or comments...

PBIL Back to PBIL home page