(data stored in ACNUC7421 zone)

EMBL: CP000088.PE385

CP000088.PE385       Location/Qualifiers
FT   CDS             complement(431084..433819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0387"
FT                   /product="protein translocase subunit secD / protein
FT                   translocase subunit secF"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0387"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54425"
FT                   /db_xref="GOA:Q47SZ2"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SZ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54425.1"
FT                   /translation="MTSSPGSGARWLRALISLLIMAGAFTAGWFLKPKLGLDLSGGTQI
FT                   VLETRDAEDGTKANASNTDLVVEVLRNRIDSLGVSEATLSRSGENRIIVELPGVQDPTE
FT                   AAEVLGQTAQLTIHPVLGVDQSIGTTGGGMFGDFRNAPADNSAEASDSEAQEEESPAED
FT                   EEGSEESTESGEEAEAVDPEDIALTLPDESGTLLQLGKPALTGDQVDRAEATLNELQTE
FT                   WLVNVEFKGAGREAWKKLTGEAACHSPGDPRRRIAIVLDNEIISAPEVDANDVACNVGM
FT                   SGGRTSITGGFDAEEAKELALLIEGGSLPLPVEEVQRQTVGPTLGAEAIKASFIAGLIG
FT                   IALTAIYISISYRFAGFLASVALLCYTVIAYAALVALGATLTLPGLAGFVLSIGMAIDA
FT                   NVLIFERTREEYQRQEKVYQANKSAGMLDATEKEQDEAAAGVVTRRRRRAIPPNLLKSF
FT                   TVGSQRAWSAVLDTNITTLIAAVLLFFLASGTVQGFGVTLGLGTIASMISALLIARVLM
FT                   EWTVSRFTPLRRLWLIGAAAVVVGLVAVLSDGLRVDNVLLLVSGALGVLAVSVAIIPLI
FT                   VRKFPRSSGIAHISAVRKWLVEHNPDLMKRSTLWLGITGVVTVLALLGFAVRSPNLGVE
FT                   FTGGRVMTFSVTEELNADQARELVAGAGYANAVVQEVEGGEISVRTGHISDQEAAKIQD
FT                   ALAEEGGEVERTSDEKIGPSMGSELRNKALIALIVALVLQMAYLAWRFRWSFGLATMLA
FT                   LAFDIILVIGLFVWLGKPIDGVFLAALLSIIGFSVNDSVVVFDRVRDEWAHKPKGDFRE
FT                   IANSSVLHTLPRTVNSGIGGLFILAALAVLGGSSLTDFSIAMLVGLISGIFSTVFVAVP
FT                   LAIWLQRFDRTPPPHEVKERKTKQRKQQRAIRERTDGAVV"
     MTSSPGSGAR WLRALISLLI MAGAFTAGWF LKPKLGLDLS GGTQIVLETR DAEDGTKANA        60
     SNTDLVVEVL RNRIDSLGVS EATLSRSGEN RIIVELPGVQ DPTEAAEVLG QTAQLTIHPV       120
     LGVDQSIGTT GGGMFGDFRN APADNSAEAS DSEAQEEESP AEDEEGSEES TESGEEAEAV       180
     DPEDIALTLP DESGTLLQLG KPALTGDQVD RAEATLNELQ TEWLVNVEFK GAGREAWKKL       240
     TGEAACHSPG DPRRRIAIVL DNEIISAPEV DANDVACNVG MSGGRTSITG GFDAEEAKEL       300
     ALLIEGGSLP LPVEEVQRQT VGPTLGAEAI KASFIAGLIG IALTAIYISI SYRFAGFLAS       360
     VALLCYTVIA YAALVALGAT LTLPGLAGFV LSIGMAIDAN VLIFERTREE YQRQEKVYQA       420
     NKSAGMLDAT EKEQDEAAAG VVTRRRRRAI PPNLLKSFTV GSQRAWSAVL DTNITTLIAA       480
     VLLFFLASGT VQGFGVTLGL GTIASMISAL LIARVLMEWT VSRFTPLRRL WLIGAAAVVV       540
     GLVAVLSDGL RVDNVLLLVS GALGVLAVSV AIIPLIVRKF PRSSGIAHIS AVRKWLVEHN       600
     PDLMKRSTLW LGITGVVTVL ALLGFAVRSP NLGVEFTGGR VMTFSVTEEL NADQARELVA       660
     GAGYANAVVQ EVEGGEISVR TGHISDQEAA KIQDALAEEG GEVERTSDEK IGPSMGSELR       720
     NKALIALIVA LVLQMAYLAW RFRWSFGLAT MLALAFDIIL VIGLFVWLGK PIDGVFLAAL       780
     LSIIGFSVND SVVVFDRVRD EWAHKPKGDF REIANSSVLH TLPRTVNSGI GGLFILAALA       840
     VLGGSSLTDF SIAMLVGLIS GIFSTVFVAV PLAIWLQRFD RTPPPHEVKE RKTKQRKQQR       900
     AIRERTDGAV V                                                            911
//

If you have problems or comments...

PBIL Back to PBIL home page