(data stored in ACNUC7421 zone)

EMBL: CP000088.PE389

CP000088.PE389       Location/Qualifiers
FT   CDS             complement(437128..437538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0391"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0391"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54429"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SY8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54429.1"
FT                   /translation="MSCTVCSPALNTTHAAHTLRAADLSRFASAGQMRSHLHRDLAGFP
FT                   AELVDDVQLCASELFANAVNHTVSGAPGGQVVRSLSLPAADRLRLEVTDSGLTPHRPRI
FT                   PDLSGTARFTAEHHRGLLLVSALALDWGTAPQ"
     MSCTVCSPAL NTTHAAHTLR AADLSRFASA GQMRSHLHRD LAGFPAELVD DVQLCASELF        60
     ANAVNHTVSG APGGQVVRSL SLPAADRLRL EVTDSGLTPH RPRIPDLSGT ARFTAEHHRG       120
     LLLVSALALD WGTAPQ                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page