(data stored in ACNUC7421 zone)

EMBL: CP000088.PE39

CP000088.PE39        Location/Qualifiers
FT   CDS             42815..43180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54079"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TY5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54079.1"
FT                   /translation="MLLGLALPTQDPELILWPLHPPRSRTRPSLAGPWRHASPQDAGQS
FT                   GRYSSVRTTAPAAGSHTASIPPQRTMADDTSRRPSPQTLNSTKQTMPVLPVNRNLAPDI
FT                   LATVLLSLQFGSPRFMG"
     MLLGLALPTQ DPELILWPLH PPRSRTRPSL AGPWRHASPQ DAGQSGRYSS VRTTAPAAGS        60
     HTASIPPQRT MADDTSRRPS PQTLNSTKQT MPVLPVNRNL APDILATVLL SLQFGSPRFM       120
     G                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page