(data stored in ACNUC7421 zone)

EMBL: CP000088.PE392

CP000088.PE392       Location/Qualifiers
FT   CDS             complement(438981..439244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0394"
FT                   /product="putative ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0394"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54432"
FT                   /db_xref="GOA:Q47SY5"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SY5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54432.1"
FT                   /translation="MRSLPGLYKRVVSGSSDDALLADLFGIDSRYSVQAEEKRQRLAQL
FT                   ESAVPRGAATPEEIDECHGVQQAVASPFTARVDEAARRISRA"
     MRSLPGLYKR VVSGSSDDAL LADLFGIDSR YSVQAEEKRQ RLAQLESAVP RGAATPEEID        60
     ECHGVQQAVA SPFTARVDEA ARRISRA                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page