(data stored in ACNUC7421 zone)

EMBL: CP000088.PE393

CP000088.PE393       Location/Qualifiers
FT   CDS             complement(440028..441494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0395"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0395"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54433"
FT                   /db_xref="GOA:Q47SY4"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SY4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54433.1"
FT                   /translation="MLRRVVGFFLIAAVLSLVMQALNLLSVFQIEIPLIIAIAVGGAAI
FT                   AEVAFPTWQARFERESALRDEQARAIREGCFTLPSGKLPQVRQLSDPLAWGVHPTAASS
FT                   GSDVVPFVPRDVDEELRAQLTKNAFVLVVGDSTAGKSRCAFEAVRAVLPRHTLIIPTAV
FT                   GSIAATLKAAERYSRRVLWLDDINRWFASPELTREAISQLLTPGKRRHRVVVATLRAAE
FT                   ADNWSTMPEEATALDTYRKVQDLLKLARLFRLDRLFSPAERERARDYVSDARIADALEH
FT                   ADEYGLAEYLANGPQRWEEWQNAWSVNTNPQAPTHPRGAALVAAAVDLRRAGYVSPIPR
FT                   ALLEEVHGIYLEQRGGERLNPEPLARAWRWATSPREGTTRLLTPYRAERVDVFDYLVDE
FT                   VQRRTPAGNHVPDQVIVTALVYASAADARSIGTTAYAQGRYRLAERAYRQAYNADLTEH
FT                   GLTHPDTLTSRNNLASVLRELGRPDEAEEI"
     MLRRVVGFFL IAAVLSLVMQ ALNLLSVFQI EIPLIIAIAV GGAAIAEVAF PTWQARFERE        60
     SALRDEQARA IREGCFTLPS GKLPQVRQLS DPLAWGVHPT AASSGSDVVP FVPRDVDEEL       120
     RAQLTKNAFV LVVGDSTAGK SRCAFEAVRA VLPRHTLIIP TAVGSIAATL KAAERYSRRV       180
     LWLDDINRWF ASPELTREAI SQLLTPGKRR HRVVVATLRA AEADNWSTMP EEATALDTYR       240
     KVQDLLKLAR LFRLDRLFSP AERERARDYV SDARIADALE HADEYGLAEY LANGPQRWEE       300
     WQNAWSVNTN PQAPTHPRGA ALVAAAVDLR RAGYVSPIPR ALLEEVHGIY LEQRGGERLN       360
     PEPLARAWRW ATSPREGTTR LLTPYRAERV DVFDYLVDEV QRRTPAGNHV PDQVIVTALV       420
     YASAADARSI GTTAYAQGRY RLAERAYRQA YNADLTEHGL THPDTLTSRN NLASVLRELG       480
     RPDEAEEI                                                                488
//

If you have problems or comments...

PBIL Back to PBIL home page