(data stored in ACNUC7421 zone)

EMBL: CP000088.PE394

CP000088.PE394       Location/Qualifiers
FT   CDS             complement(441839..442399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0396"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0396"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54434"
FT                   /db_xref="GOA:Q47SY3"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SY3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54434.1"
FT                   /translation="MTQRSTTLYIVVCAAGAAPDVGTLVSLAQEEGWTVQIIATPSAVT
FT                   FIDSSALEKQTGRPVRSTHRKPGQPRSPKAGAVIVAPATFNTINKLAHGIADNYALSVV
FT                   NEAIGLGVPVVVLPFVNSASAARLPFQRSVESLRDEGVAVLIGPGKFEPHPPGSGEKAR
FT                   AIFPWASALHALQEILQKKSVTS"
     MTQRSTTLYI VVCAAGAAPD VGTLVSLAQE EGWTVQIIAT PSAVTFIDSS ALEKQTGRPV        60
     RSTHRKPGQP RSPKAGAVIV APATFNTINK LAHGIADNYA LSVVNEAIGL GVPVVVLPFV       120
     NSASAARLPF QRSVESLRDE GVAVLIGPGK FEPHPPGSGE KARAIFPWAS ALHALQEILQ       180
     KKSVTS                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page