(data stored in ACNUC7421 zone)

EMBL: CP000088.PE4

CP000088.PE4         Location/Qualifiers
FT   CDS             4988..6121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54044"
FT                   /db_xref="GOA:Q47U20"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47U20"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54044.1"
FT                   /translation="MHVSHLQLADYRSYEAAYLELEPGVSTFIGPNGQGKTNLVEAIGY
FT                   VATHSSHRVAHDAPLVRRGAQRAVIRAAVVRHGQTALIELEINPGRANRARLNRSPNTR
FT                   MRDVLGILHTVLFAPEDLALVKGDPGERRRFLDELLTARAPRYAGVRSDYERVLKQRNA
FT                   LLKSAAAQNLHHRGGRDLPTLDVWDEHLAQIGAELLAARLALVAELQPLAAKAYGELTA
FT                   TQDPISLRYRCSATDEELDTTNRPQLVEILRAALLRARPDELRRGVSLVGPHRDDLQLW
FT                   LNDLPAKGYASQGESWSYALALRLAGFELLRADGDDPVLLLDDVFAELDAERRRRLASY
FT                   VRTAEQVLVTAAVPDDVPQELSGARFRVTGGSVERER"
     MHVSHLQLAD YRSYEAAYLE LEPGVSTFIG PNGQGKTNLV EAIGYVATHS SHRVAHDAPL        60
     VRRGAQRAVI RAAVVRHGQT ALIELEINPG RANRARLNRS PNTRMRDVLG ILHTVLFAPE       120
     DLALVKGDPG ERRRFLDELL TARAPRYAGV RSDYERVLKQ RNALLKSAAA QNLHHRGGRD       180
     LPTLDVWDEH LAQIGAELLA ARLALVAELQ PLAAKAYGEL TATQDPISLR YRCSATDEEL       240
     DTTNRPQLVE ILRAALLRAR PDELRRGVSL VGPHRDDLQL WLNDLPAKGY ASQGESWSYA       300
     LALRLAGFEL LRADGDDPVL LLDDVFAELD AERRRRLASY VRTAEQVLVT AAVPDDVPQE       360
     LSGARFRVTG GSVERER                                                      377
//

If you have problems or comments...

PBIL Back to PBIL home page